PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_6964_f_10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family VOZ
Protein Properties Length: 515aa    MW: 57621.9 Da    PI: 6.0427
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_6964_f_10genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ443.82e-1362094251217
             VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaael 95 
                     pppsaflgpkcalwdc+rpaqg++w+qdycssfha+lal eg+pg+ pvlrp+gi+lkdgllf+al ak+qgk+vgipecegaat+kspwna+el
  Neem_6964_f_10 209 PPPSAFLGPKCALWDCPRPAQGMDWCQDYCSSFHAALALSEGPPGMGPVLRPGGIGLKDGLLFSALGAKAQGKDVGIPECEGAATSKSPWNAPEL 303
                     89********************************************************************************************* PP

             VOZ  96 fdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklv 190
                     fdls+legetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvm efgglkrsyymdpqp+++fewhlyeyein++da+alyrlelklv
  Neem_6964_f_10 304 FDLSVLEGETIREWLFFDKPRRAFESGNRKQRSLPDYSGRGWHESRKQVMSEFGGLKRSYYMDPQPLNHFEWHLYEYEINKCDACALYRLELKLV 398
                     *********************************************************************************************** PP

             VOZ 191 dekksakgkvskdsladlqkklgrlta 217
                     d+k+sakgkv++ds+adlqk++grlta
  Neem_6964_f_10 399 DGKRSAKGKVTNDSVADLQKQMGRLTA 425
                     *************************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 515 aa     Download sequence    Send to blast
MGKGSKTNCK SASHKLFKDK AKNRVDDLQG MFMDLQYARK ESRSVDVAVL EEQVHQMLRE  60
WKAELNEPSP ATSLQQEGSL ATFSSDIYRL LQLCEEEDDA TSKLAAPKPE PNDQILPARD  120
SAVFHEVGYG VNQGQQQHGF PLVDQCKNSP SGVHGTTMNN LEGSTLLDYN HFDLHQDFEQ  180
NFYTGFNVST FGGEDAMHQI SGYLPSICPP PSAFLGPKCA LWDCPRPAQG MDWCQDYCSS  240
FHAALALSEG PPGMGPVLRP GGIGLKDGLL FSALGAKAQG KDVGIPECEG AATSKSPWNA  300
PELFDLSVLE GETIREWLFF DKPRRAFESG NRKQRSLPDY SGRGWHESRK QVMSEFGGLK  360
RSYYMDPQPL NHFEWHLYEY EINKCDACAL YRLELKLVDG KRSAKGKVTN DSVADLQKQM  420
GRLTAEFPSD NKRTVKGRAK VNAKVLIWPS ESNKCNDKDE EDDKFIENCD CLLCSKRYRV  480
ICHSDESIIH EKLCISLVAL KELISDGKDR NLGQK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4724671e-136AM472467.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X222410.24, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006467711.10.0PREDICTED: transcription factor VOZ1 isoform X1
RefseqXP_006467710.10.0PREDICTED: transcription factor VOZ1 isoform X1
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A067GDH60.0A0A067GDH6_CITSI; Uncharacterized protein
STRINGPOPTR_0004s05030.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM66672745
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein